SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR225W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR225W
Domain Number 1 Region: 16-114
Classification Level Classification E-value
Superfamily Histone-fold 7.87e-72
Family Nucleosome core histones 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR225W   Protein: S000002633
Sequence length 132
Comment HTA1 SGDID:S000002633, Chr IV from 915527-915925, Verified ORF, "One of two nearly identical (see also HTA2) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p"
Sequence
MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYL
AAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPK
KSAKATKASQEL
Download sequence
Identical sequences A0A0L8RN19 A0A0L8VTJ4 A0A250W916 A6ZYH9 B3LG62 C7GVC7 C8Z5D6 E7KB08 E7QD16 G0V7X3 G2WAX0 H0GE68 J4TXG6 J8PY80 N1PAF8 P04911
ORFP:4566 ORFP:4570 YDR225W YDR225W YDR225W YDR225W YDR225W 4wnn_A 4wnn_C 4wnn_E 4wnn_G 6gej_E 6gej_F 6gen_E 6gen_F YDR225W NP_010511.3.97178 XP_003673952.1.18554 XP_003674733.1.18554 XP_018223557.1.77003 XP_018223775.1.77003 ORFP:4583 4932.YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W YDR225W tr|A6ZYH9|A6ZYH9_YEAS7 YDR225W SCRT_00299 YDR225W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]