SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR320C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR320C
Domain Number 1 Region: 489-662
Classification Level Classification E-value
Superfamily Chaperone J-domain 6.93e-28
Family Chaperone J-domain 0.00058
Further Details:      
 
Domain Number 2 Region: 138-182
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000117
Family UBA domain 0.00012
Further Details:      
 
Domain Number 3 Region: 375-511
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000152
Family Tetratricopeptide repeat (TPR) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR320C   Protein: S000002728
Sequence length 668
Comment SWA2 SGDID:S000002728, Chr IV from 1108099-1106093, reverse complement, Verified ORF, "Auxilin-like protein involved in vesicular transport; clathrin-binding protein required for uncoating of clathrin-coated vesicles"
Sequence
MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP
LIPSPKVDFSAPPLVPTNSTTKSNTANNTPPSALANTDDDFNQLFGMGTVTTTDTIQKPD
EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK
QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN
DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT
KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT
DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA
SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL
ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKSMPVKKKTTTTSPATKKQN
LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL
TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK
FKLQNDIN
Download sequence
Identical sequences A6ZYS1 N1P6W8 Q06677
YDR320C YDR320C YDR320C tr|A6ZYS1|A6ZYS1_YEAS7 4932.YDR320C YDR320C YDR320C NP_010606.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]