SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR397C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR397C
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily Histone-fold 7.62e-33
Family TBP-associated factors, TAFs 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR397C   Protein: S000002805
Sequence length 146
Comment NCB2 SGDID:S000002805, Chr IV from 1266891-1266855,1266762-1266359, reverse complement, Verified ORF, "Subunit of a heterodimeric NC2 transcription regulator complex with Bur6p; complex binds to TBP and can repress transcription by preventing preinitiation complex assembly or stimulate activated transcription; homologous to human NC2beta"
Sequence
MAGDSDNVSLPKATVQKMISEILDQDLMFTKDAREIIINSGIEFIMILSSMASEMADNEA
KKTIAPEHVIKALEELEYNEFIPFLEEILLNFKGSQKVKETRDSKFKKSGLSEEELLRQQ
EELFRQSRSRLHHNSVSDPVKSEDSS
Download sequence
Identical sequences A6ZYZ7 B3LFQ4 C7GSC6 C8Z5W1 G2WBD6 N1P8T8 Q92317
YDR397C YDR397C YDR397C YDR397C SCRT_00134 YDR397C YDR397C YDR397C YDR397C YDR397C YDR397c___KOG0871 YDR397C YDR397C YDR397C tr|A6ZYZ7|A6ZYZ7_YEAS7 YDR397C YDR397C YDR397C YDR397C YDR397C YDR397C 4932.YDR397C NP_010685.1.97178 YDR397C YDR397C YDR397C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]