SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR416W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR416W
Domain Number 1 Region: 27-526
Classification Level Classification E-value
Superfamily TPR-like 1.52e-19
Family HAT/Suf repeat 0.015
Further Details:      
 
Domain Number 2 Region: 541-802
Classification Level Classification E-value
Superfamily TPR-like 1.43e-16
Family HAT/Suf repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR416W   Protein: S000002824
Sequence length 859
Comment SYF1 SGDID:S000002824, Chr IV from 1298425-1301004, Verified ORF, "Component of the spliceosome complex involved in pre-mRNA splicing; involved in regulation of cell cycle progression; similar to Drosophila crooked neck protein"
Sequence
MSAYIAMKGVITNVDENIRNDEDVAFEYEIQKTPQNILTWKRYIEYWKEEGRTDKQIRWL
YERFCSQFVTDTSIWEDYIRWESTKEVVETSRIFWLFQRCLKSCVRDCDRICLSYLELAI
EQYDLAMIRHALASSLMKMEREMHRKVWDPVIKFVEEKVLPLTQLDSTQEDEEESTDEAE
LINVLLVKGFTKGGFISEEISENGSRGDIWSSHILERYLKVAPQQKRNESLATLALTRDN
ITIKSVYEKYLPQDENSGKYLPSSELPFELNFNYLASLEKLGLDNQYEEFMRQMNGIYPD
KWLFLILSLAKYYISRGRLDSCGDLLKKSLQQTLRYSDFDRIYNFYLLFEQECSQFILGK
LKENDSKFFNQKDWTEKLQAHMATFESLINLYDIYLNDVALRQDSNLVETWMKRVSLQKS
AAEKCNVYSEAILKIDPRKVGTPGSFGRLWCSYGDLYWRSNAISTARELWTQSLKVPYPY
IEDLEEIYLNWADRELDKEGVERAFSILEDALHVPTNPEILLEKYKNGHRKIPAQTVLFN
SLRIWSKYIDYLEAYCPKDANSSDKIFNKTKMAYNTVIDLRLITPAMAENFALFLQNHYE
VMESFQVYEKTIPLFPPEIQYELWIEYLEVATSHQLSSLSPEHIRFLFEKALKNLCSNGI
DCKTIFIAYSVFEERISGLISKSIEILRRGAVIGTVSVSTHLESRLQLWRMCISKAESTL
GPSVTRELYQECIQILPNSKAVEFVIKFSDFESSIGETIRAREILAYGAKLLPPSRNTEL
WDSFEIFELKHGDKETYKDMLKMKKVLESNMLIDSASVSHEEGNINFVAAATSHAPNSHT
LTQSTSSYSINPDEIELDI
Download sequence
Identical sequences B3LFN9 C7GSB3 Q04048
YDR416w___KOG2047 SCRT_00117 YDR416W NP_010704.1.97178 YDR416W YDR416W YDR416W YDR416W YDR416W YDR416W YDR416W YDR416W YDR416W 4932.YDR416W 5lj5_T 5lqw_P 5y88_H 5ylz_H 6bk8_U

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]