SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER159C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER159C
Domain Number 1 Region: 30-137
Classification Level Classification E-value
Superfamily Histone-fold 2.72e-23
Family TBP-associated factors, TAFs 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YER159C   Protein: S000000961
Sequence length 142
Comment BUR6 SGDID:S000000961, Chr V from 491953-491525, reverse complement, Verified ORF, "Subunit of a heterodimeric NC2 transcription regulator complex with Ncb2p; complex binds to TBP and can repress transcription by preventing preinitiation complex assembly or stimulate activated transcription; homologous to human NC2alpha"
Sequence
MADQVPVTTQLPPIKPEHEVPLDAGGSPVGNMGTNSNNNNELGDVFDRIKTHFPPAKVKK
IMQTDEDIGKVSQATPVIAGRSLEFFIALLVKKSGEMARGQGTKRITAEILKKTILNDEK
FDFLREGLCVEEGQTQPEEESA
Download sequence
Identical sequences A0A0L8VS61 B3LRS2 B5VHT7 C7GQ37 C8Z7I3 E7KBZ1 E7LTV2 E7Q358 H0GFG4 N1P5E8 P40096
YER159C YER159C YER159C YER159C YER159C 4932.YER159C YER159C YER159C NYSGXRC-P048 YT9 YER159C YER159C YER159C YER159C YER159C SCRT_04634 NP_011086.3.97178 YER159C YER159C YER159C YER159C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]