SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL137W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL137W
Domain Number 1 Region: 4-314,353-381
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.24e-75
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 263-302,351-504
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000172
Family WD40-repeat 0.05
Further Details:      
 
Weak hits

Sequence:  YGL137W
Domain Number - Region: 634-749
Classification Level Classification E-value
Superfamily TPR-like 0.0149
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL137W   Protein: S000003105
Sequence length 889
Comment SEC27 SGDID:S000003105, Chr VII from 249874-249891,250092-252743, Verified ORF, "Essential beta'-coat protein of the COPI coatomer, involved in ER-to-Golgi and Golgi-to-ER transport; contains WD40 domains that mediate cargo selective interactions; 45% sequence identity to mammalian beta'-COP"
Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRA
GKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLT
VKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLT
TGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTL
PIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSL
GNDEPTLSLDPVGKLVWSGGKNAAASDIFTAVIRGNEEVEQDEPLSLQTKELGSVDVFPQ
SLAHSPNGRFVTVVGDGEYVIYTALAWRNKAFGKCQDFVWGPDSNSYALIDETGQIKYYK
NFKEVTSWSVPMHSAIDRLFSGALLGVKSDGFVYFFDWDNGTLVRRIDVNAKDVIWSDNG
ELVMIVNTNSNGDEASGYTLLFNKDAYLEAANNGNIDDSEGVDEAFDVLYELSESITSGK
WVGDVFIFTTATNRLNYFVGGKTYNLAHYTKEMYLLGYLARDNKVYLADREVHVYGYEIS
LEVLEFQTLTLRGEIEEAIENVLPNVEGKDSLTKIARFLEGQEYYEEALNISPDQDQKFE
LALKVGQLTLARDLLTDESAEMKWRALGDASLQRFNFKLAVEAFTNAHDLESLFLLHSSF
NNKEGLVTLAKDAERAGKFNLAFNAYWIAGDIQGAKDLLIKSQRFSEAAFLGSTYGLGDD
AVNDIVTKWKENLILNGKNTVSERVCGAEGLPGSSSSGDAQPLIDLDSTPAPEQADENKE
AEVEDSEFKESNSEAVEAEKKEEEAPQQQQSEQQPEQGEAVPEPVEEES
Download sequence
Identical sequences B3LHJ5 P41811
YGL137w___KOG0276 YGL137W 4932.YGL137W NP_011378.1.97178 YGL137W YGL137W SCRT_01131 YGL137W YGL137W YGL137W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]