SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR100W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR100W
Domain Number 1 Region: 216-391
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.28e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 2 Region: 368-462
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.86e-18
Family Ypt/Rab-GAP domain of gyp1p 0.022
Further Details:      
 
Domain Number 3 Region: 527-703
Classification Level Classification E-value
Superfamily EF-hand 8.93e-18
Family Calmodulin-like 0.012
Further Details:      
 
Weak hits

Sequence:  YGR100W
Domain Number - Region: 79-116
Classification Level Classification E-value
Superfamily PH domain-like 0.0338
Family VPS36 N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR100W   Protein: S000003332
Sequence length 950
Comment MDR1 SGDID:S000003332, Chr VII from 690249-693101, Verified ORF, "Cytoplasmic GTPase-activating protein for Ypt/Rab transport GTPases Ypt6p, Ypt31p and Sec4p; involved in recycling of internalized proteins and regulation of Golgi secretory function"
Sequence
MSFFDSLRQKAPFLDKLADSFTPTLTRDEKFRLKYKLPANENILEDTNAEVSFATSIKDG
KGHSDRVNNKGRKTAYVYSGRLFLTPHFLVFRDAFDHSSCVLILNISTIKRVERSPSESY
EFALLVTLYTGAKVLIQFIGIRYRSEQFCDKLKLNLKENIPNAKTLPAFLETSYSEFLIA
KNILGKKDITVPRAGLGQHFKYPGNPTMVKEKAKLRLWFDYFRENGRNLAVVQTPMFRKL
IRIGVPNRMRGEIWELCSGAMYMRYANSGEYERILNENAGKTSQAIDEIEKDLKRSLPEY
SAYQTEEGIQRLRNVLTAYSWKNPDVGYCQAMNIVVAGFLIFMSEEQAFWCLCNLCDIYV
PGYYSKTMYGTLLDQRVFESFVEDRMPVLWEYILQHDIQLSVVSLPWFLSLFFTSMPLEY
AVRIMDIFFMNGSITLFQVALAVLKINADDILQADDDGMFIAIIKHYFQTLGQSAHPDSS
DIKYRQITKFQELLVTAFKEFSVISEEMAMHARHKYEKGIFQNIETFMKRTQLRHMPKTF
NLSSDDLSNIYDMFYQSIETYKISMGTGSSNMGFEVFIQFLSKFCDSCRPCEKDKDPAFR
KQKRNFLQRLFDNWDSAHIGELTLNDVVTGLDKLVTVDLLQAINYFFSLYDTDGDGELHR
EEVLQLSEGLLLLTEPWKSGRYVDLLTKKRIEDDIAENIIKESGGEIATMNQIELPTGVT
IDEEKYKVEQAERYLKAASNFLQRSFEYAKAVDLAEEVNLIDLSDDEGEEKRTVKQKQLE
SIKANAALDPTHPKVIDLPTFRMIILADETYELFFSNTLRSSVHVDEHVNIDNKNKVLRS
MFDGILADGKRVAEQVRRRVDSVATRSSIASVESTPTAAASSITTKEEKYDDLDDFTSEH
QPENEELLQSSWFEIDDANETSTKAIQERSFEPLSANSSEEKSNLIEFEA
Download sequence
Identical sequences A0A0L8VQ72 A6ZV82 B3LIC6 C7GWW3 E7KCX5 H0GGM1 P53258
YGR100W tr|A6ZV82|A6ZV82_YEAS7 YGR100W YGR100W YGR100W 4932.YGR100W YGR100W NP_011614.1.97178 YGR100W YGR100W YGR100W YGR100W YGR100W SCRT_00917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]