SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL073C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIL073C
Domain Number - Region: 452-554
Classification Level Classification E-value
Superfamily TPR-like 0.00237
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YIL073C   Protein: S000001335
Sequence length 975
Comment SPO22 SGDID:S000001335, Chr IX from 225951-225897,225806-222934, reverse complement, Verified ORF, "Meiosis-specific protein essential for chromosome synapsis, involved in completion of nuclear divisions during meiosis; induced early in meiosis"
Sequence
MSDHNVNSTFRKTLVELCETATWITSQVYAAKNLEKNDLITVDNKISALYPIAEKYDRSF
RTTTVILDEELILKLENAASSLWNSLTIAMKAEKASDKYFNEVFCKCKIFATKLLSIHEA
LFRTNTNLLRNFKCYISSFKSASEYRFDDLITNTQQHSEKYLQIINENVESFSNEEKTEF
KKLTFEFYLVNFQLYLSENDLDTANIYTAKVNITDNSKYMDADLLIELCRMIYNSTVMLK
EINNPETQLVDVNIISFLKDVEKYLELPVENLKSHTDYSNLKYSVLIFMANCLVEGHPQA
SELEQCDHYLSLLQNEYPNKVDPFILAINLTKRRNIVNPAETIEEILMRMIMSVDVISNF
QAVIASINDLSKMNTKFSIVCLDYLLINKLNSKNDSKFLGKAICSRFLITTQSKTMNDSE
IAESLENFSTQMERIVSEPLTKHAISCIITLLWNTGKKLEKMEKYVVSIRFYKLALKDII
SQNYSDRGKIQRALQVVYNKIEDYSNTVRVYQDMDEVDRQSPLCQLLMLQSFLADDKTEE
ALTCLQKIKSSEDEKSTDALILAVAECKRKTDLSVQGLLMIFDKLQSKSNSQTISSTSSS
QTLSILRYTLQMIVKVSEEEPLETFINYLPTVQKLLQKAVEFLKTVKLLNQLPPDVEKEA
IYQQSVAVNEIEWFASFSYNVAVKCLVDQSCESISEFPQYCIQFIDLIPVQDFTFPKMYH
FTYWRFKATILQLIIAKEKAKQDQHQKDWDIYEKSEELVNSINVMKKSSEFKDGSSLEDR
NTLHECFLEALTIHLESALMMPDQTRILDILKKTELYQDSRVDALLIDISSNMEDLPKGV
LIEILETVLKRNMGPEVKERELCSWLRILLENAINLNHEVELRILDRVLKILNINQSSLQ
DTDGVLQTELETIATYCWNIGVNYIIKDNKSNGIVWCKHSMGFANMVNEGLQEQLYSLWE
SLASSANIDINSIAK
Download sequence
Identical sequences N1P0Z1 P40511
YIL073C YIL073C YIL073C 4932.YIL073C NP_012192.2.97178 YIL073C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]