SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL065C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL065C
Domain Number 1 Region: 20-107
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000256
Family TBP-associated factors, TAFs 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL065C   Protein: S000003601
Sequence length 167
Comment DLS1 SGDID:S000003601, Chr X from 315552-315049, reverse complement, Verified ORF, "Subunit of ISW2/yCHRAC chromatin accessibility complex along with Itc1p, Isw2p, and Dpb4p; involved in inheritance of telomeric silencing"
Sequence
MNNETSGKETASAPLCSPKLPVEKVQRIAKNDPEYMDTSDDAFVATAFATEFFVQVLTHE
SLHRQQQQQQQQVPPLPDELTLSYDDISAAIVHSSDGHLQFLNDVIPTTKNLRLLVEENR
VRYTTSVMPPNEVYSAYVVNDTAPKPNIVEIDLDNDEDDDEDVTDQE
Download sequence
Identical sequences A0A0L8VMT5 A0A250WHW5 A6ZPQ7 B3LQ45 C7GR47 C8ZBE8 E7KE96 E7KQC5 E7Q5G4 G2WGV1 H0GIC6 N1P8H0 P40366
YJL065C SCRT_03605 YJL065C YJL065C CX00011 YJL065C YJL065C YJL065C YJL065C YJL065C YJL065C YJL065C 4932.YJL065C YJL065C YJL065C YJL065C YJL065C YJL065C YJL065C tr|A6ZPQ7|A6ZPQ7_YEAS7 YJL065C YJL065C YJL065C YJL065C YJL065C NP_012470.1.97178 YJL065C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]