SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL082W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YJL082W
Domain Number - Region: 404-503
Classification Level Classification E-value
Superfamily TPR-like 0.000456
Family Tetratricopeptide repeat (TPR) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL082W   Protein: S000003618
Sequence length 731
Comment IML2 SGDID:S000003618, Chr X from 281180-283375, Verified ORF, "Protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies"
Sequence
MFRVFGSFGSKGNQSSGEEQSTKTKQVLKQANDFEIALKAMDFVLDDRTDEGLNLLKKAE
METGSDQTILTLARGVIEFLQATLSFETEEMKRAAITLGKAEQMSWKSKQNAEKTNFRSS
SIYPPGTVYAVTYTESCLLHALLMLFSESMMEAAKALLKLRRAYTMLQDIMVTVKKAERS
KNSSSPSPSEKSQESCGSFVSAETTFISVDIPYKLSSEDKSNPLLLEFAEKIYTMRMGRL
SGAHIGNTPSFHRLRDDLGLQTTPSQASDRHSVSDDFDLEQATIDEFIHSGANLCYGILQ
VVLSLLPPAIGAVLSIVGFKGSREEGLRLVWKATKERNVHGCIGLLGLMFYYDGPFQFTD
ADFDIPPNDNGSRALNKSRTNDSSLLPGYMDSATLLHPGKILEDALLKARALFPNSALWL
LNEAKMLAGKGRLRDSLALMDSIDVNSIRMRQVKSLMVFERAILLVNLHEYNRAADDLIS
LLDISDWSHALYTYFAGCCYLENWRMTQLGLLNDGKEQFYKERARELIFDAPSLLGKKTF
KSKNLPLDRFMLRKVQQFNNMQKKLNLQEPLDSIATSPVHELAYFYNGYNRMTENDLILT
KKMLTEYHNPAIDSEDPDQELIRNLLLSLTLRRLGDAERGLALLDDIVLPKIFYIQNGKV
KYFKKTEDPWAYPAALYERALFCWKLGGMESLNECREWLLRAQNYAADYELSTRIGMKIK
AALDRVENALA
Download sequence
Identical sequences A0A0L8VMS1 B3LQ30 B5VL95 C7GR31 D3UF60 H0GIB3 N1P8G1 P47031
NP_012453.1.97178 YJL082W YJL082W YJL082W YJL082W YJL082W 4932.YJL082W SCRT_03589 YJL082W YJL082W YJL082W YJL082W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]