SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJR032W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR032W
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily Cyclophilin-like 9.94e-56
Family Cyclophilin (peptidylprolyl isomerase) 0.0000196
Further Details:      
 
Domain Number 2 Region: 238-383
Classification Level Classification E-value
Superfamily TPR-like 1.44e-21
Family Tetratricopeptide repeat (TPR) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YJR032W   Protein: S000003793
Sequence length 393
Comment CPR7 SGDID:S000003793, Chr X from 491074-492255, Verified ORF, "Peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds to Hsp82p and contributes to chaperone activity"
Sequence
MIQDPLVYLDISIDKKPIGRIVCKLFREKAPKTTENFYKLCAGDVKSPLKDQQYLSYKGN
GFHRVVKNFMIQAGDIVFGTQKDSSSSSVGKGGCSIYADKEEVKTDDESFCYGNFEDENL
GEFVEPFTLGMANLGSPNTNNSQFFITTYAAPHLNGKHSIFGQVVHGKSVVRTIENCRVD
SDGVPESDVRISDCGVWEKTMGVPLYNASNDQIGGDVYEEYPDDDTHFGDDDFGKALEAA
NIIKESGTLLFKKKDYSNAFFKYRKSLNYINEYMPEPDVDKERNIQFINLKMKIYLNLSL
VLFNLERYDDAIMYATYLLEMDNVPNRDQAKAYYRRGNSYLKKKRLDEALQDYIFCKEKN
PDDEVIEQRIEYVNRLIEENKEKTRKNISKFFS
Download sequence
Identical sequences A6ZPZ3 G2WH38 N1P019 P47103
YJR032W YJR032W YJR032W YJR032W NP_012566.1.97178 YJR032W tr|A6ZPZ3|A6ZPZ3_YEAS7 YJR032W YJR032W YJR032W 4932.YJR032W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]