SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJR075W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR075W
Domain Number 1 Region: 117-328
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.19e-19
Family Glycosylating toxin catalytic domain-like 0.026
Further Details:      
 
Weak hits

Sequence:  YJR075W
Domain Number - Region: 32-105
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0314
Family BAR domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YJR075W   Protein: S000003836
Sequence length 396
Comment HOC1 SGDID:S000003836, Chr X from 573974-575164, Verified ORF, "Alpha-1,6-mannosyltransferase involved in cell wall mannan biosynthesis; subunit of a Golgi-localized complex that also contains Anp1p, Mnn9p, Mnn11p, and Mnn10p; identified as a suppressor of a cell lysis sensitive pkc1-371 allele"
Sequence
MAKTTKRASSFRRLMIFAIIALISLAFGVRYLFHNSNATDLQKILQNLPKEISQSINSAN
NIQSSDSDLVQHFESLAQEIRHQQEVQAKQFDKQRKILEKKIQDLKQTPPEATLRERIAM
TFPYDSHVKFPAFIWQTWSNDEGPERVQDIKGMWESKNPGFAHEVLNHDVINALVHHYFY
SIPEILETYEALPSIILKIDFFKYLILLVHGGVYADIDTFPVQPIPNWIPEELSPSDIGL
IVGVEEDAQRADWRTKYIRRLQFGTWIIQAKPGHPVLREIISRIIETTLQRKRDDQLNVN
LRNDLNIMSWTGSGLWTDTIFTYFNDFMRSGVREKVTWKLFHNLNQPKLLSDVLVFPKFS
FNCPNQIDNDDPHKKFYFITHLASQFWKNTPKVEQK
Download sequence
Identical sequences B3LQG1 C7GMC9 E7Q5Q1 G2WH79 N1P154 P47124
YJR075W YJR075W YJR075W NP_012609.3.97178 YJR075W YJR075W YJR075W YJR075W YJR075W YR199 4932.YJR075W YJR075W SCRT_03727 YJR075W YJR075W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]