SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKL049C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL049C
Domain Number 1 Region: 113-227
Classification Level Classification E-value
Superfamily Histone-fold 4.02e-34
Family Nucleosome core histones 0.0000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YKL049C   Protein: S000001532
Sequence length 229
Comment CSE4 SGDID:S000001532, Chr XI from 346408-345719, reverse complement, Verified ORF, "Centromere protein that resembles histones, required for proper kinetochore function; homolog of human CENP-A"
Sequence
MSSKQQWVSSAIQSDSSGRSLSNVNRLAGDQQSINDRALSLLQRTRATKNLFPRREERRR
YESSKSDLDIETDYEDQAGNLEIETENEEEAEMETEVPAPVRTHSYALDRYVRQKRREKQ
RKQSLKRVEKKYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQS
MAIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI
Download sequence
Identical sequences A0A0L8VMT2 A0A250WIX6 A6ZZR7 B3LR40 B5VMA8 C7GP25 C8ZCC3 E7KEY6 E7KR32 E7LWW1 E7QHA4 G2WHY3 H0GJ83 N1P2E0 P36012
YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C SCRT_03972 NP_012875.2.97178 YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C YKL049C tr|A6ZZR7|A6ZZR7_YEAS7 4932.YKL049C YKL049C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]