SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKL113C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL113C
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily PIN domain-like 2.85e-66
Family 5' to 3' exonuclease catalytic domain 0.000000212
Further Details:      
 
Domain Number 2 Region: 216-354
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 6.88e-38
Family 5' to 3' exonuclease, C-terminal subdomain 0.0000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YKL113C   Protein: S000001596
Sequence length 382
Comment RAD27 SGDID:S000001596, Chr XI from 225519-224371, reverse complement, Verified ORF, "5' to 3' exonuclease, 5' flap endonuclease, required for Okazaki fragment processing and maturation as well as for long-patch base-excision repair; member of the S. pombe RAD2/FEN1 family"
Sequence
MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAGE
TTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLAEATTELE
KMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAASEDMDT
LCYRTPFLLRHLTFSEAKKEPIHEIDTELVLRGLDLTIEQFVDLCIMLGCDYCESIRGVG
PVTALKLIKTHGSIEKIVEFIESGESNNTKWKIPEDWPYKQARMLFLDPEVIDGNEINLK
WSPPKEKELIEYLCDDKKFSEERVKSGISRLKKGLKSGIQGRLDGFFQVVPKTKEQLAAA
AKRAQENKKLNKNKNKVTKGRR
Download sequence
Identical sequences A0A0L8VM65 A0A250WIW5 A6ZZK4 C7GVJ8 C8ZC62 E7KQZ1 H0GJ32 N1P312 P26793
NP_012809.1.97178 YKL113C YKL113C YKL113C YKL113C YKL113C YKL113C YKL113C YKL113C YKL113C NYSGXRC-P076 4932.YKL113C YKL113C YKL113C tr|A6ZZK4|A6ZZK4_YEAS7 YKL113C YKL113c___KOG2519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]