SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR097C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR097C
Domain Number 1 Region: 87-152
Classification Level Classification E-value
Superfamily F-box domain 0.00000458
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  YLR097C
Domain Number - Region: 12-49
Classification Level Classification E-value
Superfamily TPR-like 0.0683
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR097C   Protein: S000004087
Sequence length 344
Comment HRT3 SGDID:S000004087, Chr XII from 337266-336232, reverse complement, Verified ORF, "Putative SCF-ubiquitin ligase F-box protein, based on both genetic and physical interactions and sequence similarity; identified in association with Cdc53p, Skp1p and Ubi4 in large and small-scale studies"
Sequence
MIVDYEKDPRAKEAIAIWEKGVLKEKDGSMSDAINFYRSALKIHDNVESLYRKKILDEWM
LHKKLSGLSMTTDAPDEQNETGKDDLSVEENAELQPCWILEILPDDILLRIIKKVILMSG
ESWVNLSMTCSTFSKLCFHDSVPFKTFAKYIYSKQIYDKMAMDLNGITDINTFEKEIWRG
DDYRMLRERPYIKFEGVYISVVNYVRYGSNAESSLSLLKPVHMITYYRYFRFYENGQCLR
LLSTDEPSAVVKHFSKENKPRHSHMCYWSLGFDYDFGHLKITRSDEKYTFIEEFQIKNQG
NKRYQRLKWLSSIVVDKEGNASNCSLRNEKSFFFSRVKSFKDPG
Download sequence
Identical sequences A0A250WLQ1 E7NKE7 E7Q6L1 G2WIU0 Q12347
355467 4932.YLR097C YLR097C YLR097C NP_013198.1.97178 YLR097C YLR097C YLR097C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]