SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR363C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLR363C
Domain Number - Region: 4-69,133-159
Classification Level Classification E-value
Superfamily PIN domain-like 0.00785
Family PIN domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR363C   Protein: S000004355
Sequence length 218
Comment NMD4 SGDID:S000004355, Chr XII from 853150-852494, reverse complement, Verified ORF, "Protein interacting with Nam7p, may be involved in the nonsense-mediated mRNA decay pathway"
Sequence
MTQYNFIIDASAFEKGLGNIKRWCSDCTEAVTLNFYIPTFTLNELDFLQQRRKSFAARES
LKFIDRLDDSKFANLKVFIEFPEVLDIILWSDVMEHNDSSGKINIAKLPKRLKNLLKSCI
YKCYLEGNEGLHWFLISEDPQIREMAMQCNIPSCSIVDVDSILSKDMNDKSFRESEKFNN
MMLKNGTKEESENGREIIRTNFNKTVYASRGTGELWSP
Download sequence
Identical sequences E7NL05 G2WJI1 N1NZP9 Q12129
YLR363C YLR363C YLR363C YLR363C YLR363C YLR363C YLR363C YLR363C YLR363C NP_013467.3.97178 4932.YLR363C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]