SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML015C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML015C
Domain Number 1 Region: 132-198
Classification Level Classification E-value
Superfamily Histone-fold 4.81e-16
Family TBP-associated factors, TAFs 0.0037
Further Details:      
 
Weak hits

Sequence:  YML015C
Domain Number - Region: 303-325
Classification Level Classification E-value
Superfamily Histone-fold 0.0921
Family TBP-associated factors, TAFs 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YML015C   Protein: S000004477
Sequence length 346
Comment TAF11 SGDID:S000004477, Chr XIII from 243029-241989, reverse complement, Verified ORF, "TFIID subunit (40 kDa), involved in RNA polymerase II transcription initiation, similar to histone H3 with atypical histone fold motif of Spt3-like transcription factors"
Sequence
MTEPQGPLDTIPKVNYPPILTIANYFSTKQMIDQVISEDQDYVTWKLQNLRTGGTSINNQ
LNKYPKYKYQKTRINQQDPDSINKVPENLIFPQDILQQQTQNSNYEDTNTNEDENEKLAQ
DEQFKLLVTNLDKDQTNRFEVFHRTSLNKTQVKKLASTVANQTISENIRVFLQAVGKIYA
GEIIELAMIVKNKWLTSQMCIEFDKRTKIGYKLKKYLKKLTFSIIENQQYKQDYQSDSVP
EDEPDFYFDDEEVDKRETTLGNSLLQSKSLQQSDHNSQDLKLQLIEQYNKLVLQFNKLDV
SIEKYNNSPLLPEHIREAWRLYRLQSDTLPNAYWRTQGEGQGSMFR
Download sequence
Identical sequences A0A250WEX2 A6ZM47 G2WK37 N1P035 Q04226
YML015C YML015C YML015C 4932.YML015C YML015C YML015C YML015C YML015C NP_013697.1.97178 YML015C YML015C tr|A6ZM47|A6ZM47_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]