SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML098W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML098W
Domain Number 1 Region: 11-53
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000167
Family TBP-associated factors, TAFs 0.046
Further Details:      
 
Weak hits

Sequence:  YML098W
Domain Number - Region: 26-136
Classification Level Classification E-value
Superfamily ARM repeat 0.0253
Family Exportin HEAT-like repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YML098W   Protein: S000004564
Sequence length 167
Comment TAF13 SGDID:S000004564, Chr XIII from 77267-77770, Verified ORF, "TFIID subunit (19 kDa), involved in RNA polymerase II transcription initiation, similar to histone H4 with atypical histone fold motif of Spt3-like transcription factors"
Sequence
MSRKLKKTNLFNKDVSSLLYAYGDVPQPLQATVQCLDELVSGYLVDVCTNAFHTAQNSQR
NKLRLEDFKFALRKDPIKLGRAEELIATNKLITEAKKQFNETDNQNSLKRYREEDEEGDE
MEEDEDEQQVTDDDEEAAGRNSAKQSTDSKATKIRKQGPKNLKKTKK
Download sequence
Identical sequences A0A250WFT1 G2WJV9 P11747
YML098W NP_013611.1.97178 XP_015331518.1.40921 YML098W YML098W YT66 YML098W YML098W YML098W YML098W YML098W 4932.YML098W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]