SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR115W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR115W
Domain Number - Region: 126-195,437-470
Classification Level Classification E-value
Superfamily TPR-like 0.00375
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR115W   Protein: S000004721
Sequence length 501
Comment FMP24 SGDID:S000004721, Chr XIII from 497703-499208, Uncharacterized ORF, "Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies"
Sequence
MLLQGMRLSQRLHKRHLFASKILTWTTNPAHIRHLHDIRPPASNFNTQESAPIPESPANS
PTRPQMAPKPNLKKKNRSLMYSIIGVSIVGLYFWFKSNSRKQKLPLSAQKVWKEAIWQES
DKMDFNYKEALRRYIEALDECDRSHVDLLSDDYTRIELKIAEMYEKLNMLEEAQNLYQEL
LSRFFEALNVPGKVDESERGEVLRKDLRILIKSLEINKDIESGKRKLLQHLLLAQEEILS
KSPELKEFFENRKKKLSMVKDINRDPNDDFKTFVSEENIKFDEQGYMILDLEKNSSAWEP
FKEEFFTARDLYTAYCLSSKDIAAALSCKITSVEWMVMADMPPGQILLSQANLGSLFYLQ
AEKLEADLNQLEQKKSKESNQELDMGTYIKAVRFVRKNRDLCLERAQKCYDSVIAFAKRN
RKIRFHVKDQLDPSIAQSIALSTYGMGVLSLHEGVLAKAEKLFKDSITMAKETEFNELLA
EAEKELEKTTVLKAAKKEGLN
Download sequence
Identical sequences Q04472
YMR115W YMR115W 4932.YMR115W NP_013833.1.97178 YMR115W YMR115W YMR115W YMR115W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]