SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL030W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL030W
Domain Number 1 Region: 26-103
Classification Level Classification E-value
Superfamily Histone-fold 1.39e-59
Family Nucleosome core histones 0.0000108
Further Details:      
 
Domain Number 2 Region: 10-102
Classification Level Classification E-value
Superfamily CATH 2.99e-38
Family CATH 0.0000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL030W   Protein: S000004975
Sequence length 103
Comment HHF2 SGDID:S000004975, Chr XIV from 576728-577039, Verified ORF, "One of two identical histone H4 proteins (see also HHF1); core histone required for chromatin assembly and chromosome function; contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity"
Sequence
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLK
SFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Download sequence
Identical sequences A0A0L8RN31 A0A0L8VV91 A0A250WG92 A6ZKV6 B3LND1 C7GM41 C8Z404 E7K9P7 E7KTN8 E7LR46 E7NER0 E7Q0U8 E7QBC8 G2W917 H0GC86 J5S3K3 J8QAJ7 N1PAQ9 P02309
YBR009C YNL030W YNL030W NP_009563.1.97178 NP_014368.1.97178 XP_018219846.1.77003 XP_018223567.1.77003 YBR009C YNL030W YNL030W YBR009C YNL030W YBR009C YNL030W YBR009C YNL030W YNL030W SCRT_02955 SCRT_03161 YBR009C YNL030W YBR009C YNL030W YBR009C YNL030W YNL030W YBR009C YBR009C YNL030W YBR009C YNL030W 4932.YBR009C 4932.YNL030W YNL030W YBR009C YNL030W YBR009C YNL030W tr|A6ZKV6|A6ZKV6_YEAS7 YBR009C YNL030W YBR009C YBR009C YBR009C 4kud_B 4kud_F 5zba_D 5zbb_D 6gej_C 6gej_D 6gen_C 6gen_D ORFP:1254 ORFP:18879 YBR009C YNL030W YNL030W YBR009C ORFP:1029 ORFP:19225 ORFP:21528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]