SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL031C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL031C
Domain Number 1 Region: 40-134
Classification Level Classification E-value
Superfamily Histone-fold 2.92e-79
Family Nucleosome core histones 0.00000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL031C   Protein: S000004976
Sequence length 136
Comment HHT2 SGDID:S000004976, Chr XIV from 576051-575641, reverse complement, Verified ORF, "One of two identical histone H3 proteins (see also HHT1); core histone required for chromatin assembly, involved in heterochromatin-mediated telomeric and HM silencing; regulated by acetylation, methylation, and mitotic phosphorylation"
Sequence
MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI
QKKDIKLARRLRGERS
Download sequence
Identical sequences A0A0A8L8J9 A0A0C7NC57 A0A0L8RCL4 A0A0L8VIS1 A0A0P1KVL8 A0A0W0DI46 A0A109UYR9 A0A1E5R0T0 A0A1G4IU80 A0A1G4J6I4 A0A1G4JHE7 A0A1G4JJM1 A0A1G4M9Z9 A0A1Q3AJU6 A0A1S7HXD2 A0A1X7R944 A0A212MFU7 A0A250WFQ4 A6ZKV7 A7TEJ6 B3LND0 C5DMP9 C5DPC3 C7GM40 C8Z405 E7K9P8 E7KTN7 E7LR47 E7NER1 E7Q0U9 E7QBC9 G0V9T6 G0WDJ1 G2WL38 G8BVI6 G8JRQ9 G8ZTR9 H0H0E2 H2B0P7 I2H5H0 J7S2Q8 J8PX31 N1P868 P61830 P61831 P61833 P61836 Q757N1 R9XFU4 S6F2S9 W0TGF0
gnl|GLV|ZYRO0A02178g gnl|GLV|ZYRO0A04818g 4kud_A 4kud_E 5zba_C 5zbb_C gnl|GLV|KLTH0G10670g gnl|GLV|KLTH0G16258g YBR010W tr|A7TEJ6|A7TEJ6_VANPO gnl|GLV|KLLA0E17623g ORFP:21072 ORFP:21522 YBR010W YNL031C YBR010W YNL031C YBR010W YNL031C ORFP:1034 ORFP:19223 sp|Q757N1|H3_ASHGO YBR010W YNL031C gnl|GLV|CAGL0C04114g gnl|GLV|CAGL0H09856g gnl|GLV|CAGL0M06655g YBR010W YNL031C YBR010W YNL031C YBR010W YNL031C gnl|GLV|SAKL0E07326g NP_009564.1.97178 NP_014367.1.97178 NP_983894.1.49492 NP_984873.1.49492 XP_001644599.1.22633 XP_001645705.1.22633 XP_001647161.1.22633 XP_002494467.1.66507 XP_002494580.1.66507 XP_002555497.1.30775 XP_002555741.1.30775 XP_003645645.1.63417 XP_003646887.1.63417 XP_003668626.1.30128 XP_003671095.2.30128 XP_003675074.1.18554 XP_003676571.1.18554 XP_003677609.1.18554 XP_003681224.1.64532 XP_003682806.1.64532 XP_003683947.1.77742 XP_003684934.1.77742 XP_003686348.1.77742 XP_003954701.1.94514 XP_003956199.1.94514 XP_003959332.1.94514 XP_004178945.1.8396 XP_004181141.1.8396 XP_017986793.1.1318 XP_017987509.1.1318 XP_018219845.1.77003 XP_018223568.1.77003 XP_445354.1.27851 XP_447226.1.27851 XP_449637.1.27851 XP_454744.1.35115 YBR010W YNL031C YBR010W YNL031C SCRT_02954 SCRT_03160 YNL031C YBR010W YNL031C YBR010W YNL031C ORFP:1253 ORFP:18877 28985.P61831 33169.AGOS_ADL202C 33169.AGOS_AER013W 436907.A7TEJ6 4932.YBR010W 4932.YNL031C 559295.KLTH0G10670g 559295.KLTH0G16258g 559307.ZYRO0A02178g 559307.ZYRO0A04818g YBR010W YNL031C YBR010W YNL031C Kwal_10967 Kwal_11478 YBR010W YBR010W YNL031C YBR010W YNL031C YBR010W YNL031C YBR010W YNL031C YBR010W YNL031C tr|A6ZKV7|A6ZKV7_YEAS7 YBR010W YNL031C YBR010W YNL031C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]