SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL085W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL085W
Domain Number 1 Region: 3-109,148-246
Classification Level Classification E-value
Superfamily PIN domain-like 4.32e-30
Family 5' to 3' exonuclease catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL085W   Protein: S000005029
Sequence length 830
Comment MKT1 SGDID:S000005029, Chr XIV from 467133-469625, Verified ORF, "Protein that forms a complex with Pbp1p that may mediate posttranscriptional regulation of HO endonuclease; involved in propagation of M2 dsRNA satellite of L-A virus; contains a DTG signature typical of retroviral proteases"
Sequence
MAIKSLESFLFERGLVGSYAIEALNNCTLDIDVNHYVSRLLTNKREQYLDAIGGFPTSLK
MYLESDLKIFKDFNITPIFVFNGGLTYNQLEASGHFTAASASASISSTTTSSSGTNATTR
SNTESVLLQRSRGWTQWNNLISSNQNSYIDQPIQPQEPFRHNTTIDSKAYQNDLIAYFIE
HGYMYQVAPYSSWFQLAYLLNSAYIDAIYGPTDCLMLDCVDRFILGMEFPNKEFRFIDRS
RVMKDLGCTHEEFIDIAMAVGNDLQPTTLPPLQIYPVPQLFDIALEMVLNTGTNFYAYQL
STTLQNDSKENIQNYQRGISALRYMPVLKDTGKVELFVQEIVVSEEDSEKNNKDGKKSNL
SSPSSASSSASPATTVTKNASEKLTYEKSSTKEVRKPRDIPNDVHDFIGQMLPHEYYFYR
SIGLVTGKLFDAIVTGVYPEEPPLGGGSSTSYKKLVSKSVEIFKNKEINLLTQPINRYYQ
IKQIKQVKWYAANEPTTLTNRMSPSMFETINHLIVKTETSDEKEFSISEFITTINGSSNM
AKDFISEKVIFPNSVPIESKLNSPFNLLSTNFLRLLVLLEFFTFDFKEKLLEPTRWGEVF
LKLNELNIDSKYHESVIIFLVFLKCDVLKLDEEVQPPAPSALSQATLRSYPEESLYVLLI
TRVLTLFQVDQKPSNYHGPIDKKTLIFRDHLSFIKENLNELFEAVLISSLTSGEFNRLSL
DNFGWARKIVRYLPFKLDSPNTIMAMMWEFFLQKYLHNGNAKNDALSLVATEFNTYKSTP
NLDEQFVESHRFLLEISKVMQELNAAKLIDENVFKLFTKAVEFTTTALSS
Download sequence
Identical sequences P40850
NP_014314.3.97178 YNL085W YNL085W YNL085W 4932.YNL085W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]