SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL012C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL012C
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily Histone-fold 7.19e-40
Family Nucleosome core histones 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOL012C   Protein: S000005372
Sequence length 134
Comment HTZ1 SGDID:S000005372, Chr XV from 303984-303580, reverse complement, Verified ORF, "Histone variant H2AZ, exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin"
Sequence
MSGKAHGGKGKSGAKDSGSLRSQSSSARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYL
TAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHIN
KALLLKVEKKGSKK
Download sequence
Identical sequences A0A0L8VIG1 A0A250WB13 A6ZNJ4 B3LJ44 C7GJW4 C8ZHV3 E7KHR9 E7KU55 E7M055 E7Q953 E7QKJ1 G2WML9 H0GNA5 N1NY54 Q12692
YOL012C YOL012C YOL012C YOL012C YOL012C YOL012C YOL012C YOL012C YOL012C YOL012C YOL012C YOL012C NP_014631.1.97178 tr|A6ZNJ4|A6ZNJ4_YEAS7 YOL012C SCRT_01391 YOL012C YOL012C YOL012C YOL012C YOL012C 4932.YOL012C YOL012C YOL012C YOL012C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]