SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL086W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL086W-A
Domain Number 1 Region: 24-81
Classification Level Classification E-value
Superfamily Histone-fold 0.00000064
Family TBP-associated factors, TAFs 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOL086W-A   Protein: S000007626
Sequence length 90
Comment YOL086W-A SGDID:S000007626, Chr XV from 159173-159445, Uncharacterized ORF, "Putative protein of unknown function; identified by homology"
Sequence
MNDDEDRAQLKARLWIRVEERLQQVLSSEDIKYTPRFINSLLELAYLQLGEMGSDLQAFA
RHAGRGVVNKSDLMLYLRKQPDLQERVTQE
Download sequence
Identical sequences N1P409 Q3E835
NP_076910.1.97178 YOL086W-A YOL086w-a YOL086W-A YOL086W-A YOL086W-A 4932.YOL086W-A 3v9r_A 3v9r_C YOL086W-A YOL086W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]