SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL145C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL145C
Domain Number 1 Region: 186-413
Classification Level Classification E-value
Superfamily HCP-like 2.54e-17
Family HCP-like 0.014
Further Details:      
 
Domain Number 2 Region: 678-856
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000228
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Domain Number 3 Region: 436-624
Classification Level Classification E-value
Superfamily TPR-like 0.00000000531
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 4 Region: 53-160
Classification Level Classification E-value
Superfamily TPR-like 0.00000348
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YOL145C   Protein: S000005505
Sequence length 1077
Comment CTR9 SGDID:S000005505, Chr XV from 52787-49554, reverse complement, Verified ORF, "Component of the Paf1p complex, which is a large complex that binds to and modulates the activity of RNA polymerase II and is required for expression of a subset of genes, including cyclin genes; contains TPR repeats"
Sequence
MTNAMKVEGYPSMEWPTSLDIPLKASEELVGIDLETDLPDDPTDLKTLLVEENSEKEHWL
TIALAYCNHGKTNEGIKLIEMALDVFQNSERASLHTFLTWAHLNLAKGQSLSVETKEHEL
TQAELNLKDAIGFDPTWIGNMLATVELYYQRGHYDKALETSDLFVKSIHAEDHRSGRQSK
PNCLFLLLRAKLLYQKENYMASLKIFQELLVINPVLQPDPRIGIGLCFWQLKDSKMAIKS
WQRALQLNPKNTSASILVLLGEFRESFTNSTNDKTFKEAFTKALSDLNNIFSENQHNPVL
LTLLQTYYYFKGDYQTVLDIYHHRILKMSPMIAKIVLSESSFWCGRAHYALGDYRKSFIM
FQESLKKNEDNLLAKLGLGQTQIKNNLLEESIITFENLYKTNESLQELNYILGMLYAGKA
FDAKTAKNTSAKEQSNLNEKALKYLERYLKLTLATKNQLVISRAYLVISQLYELQNQYKT
SLDYLSKALEEMEFIKKEIPLEVLNNLACYHFINGDFIKADDLFKQAKAKVSDKDESVNI
TLEYNIARTNEKNDCEKSESIYSQVTSLHPAYIAARIRNLYLKFAQSKIEDSDMSTEMNK
LLDLNKSDLEIRSFYGWYLKNSKERKNNEKSTTHNKETLVKYNSHDAYALISLANLYVTI
ARDGKKSRNPKEQGKSKHSYLKAIQLYQKVLQVDPFNIFAAQGLAIIFAESKRLGPALEI
LRKVRDSLDNEDVQLNLAHCYLEMREYGKAIENYELVLKKFDNEKTRPHILNLLGRAWYA
RAIKETSVNFYQKALENAKTALDLFVKESSKSKFIHSVKFNIALLHFQIAETLRRSNPKF
RTVQQIKDSLEGLKEGLELFRELNDLKEFNMIPKEELEQRIQLGETTMKSALERSLNEQE
EFKKEQRAKIDEARKILEENELKEQGWMKQEEEARRLKLEKQAEEYRKLQDEAQKIFQVR
EAMAISEHNVKDDSDLSDKDNEYDEEQPRQKRKRSTKTKNSGESKRRKAAKKTLSDSDED
DDDVVKKPSHNKGKKSQLSNEFIEDSDEEEAQMSGSEQNKNDDNDENNDNDDNDGLF
Download sequence
Identical sequences 4932.YOL145C YOL145C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]