SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR033C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR033C
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily PIN domain-like 8.83e-62
Family 5' to 3' exonuclease catalytic domain 0.00077
Further Details:      
 
Domain Number 2 Region: 212-311
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.21e-21
Family 5' to 3' exonuclease, C-terminal subdomain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR033C   Protein: S000005559
Sequence length 702
Comment EXO1 SGDID:S000005559, Chr XV from 394524-392416, reverse complement, Verified ORF, "5'-3' exonuclease and flap-endonuclease involved in recombination, double-strand break repair and DNA mismatch repair; member of the Rad2p nuclease family, with conserved N and I nuclease domains"
Sequence
MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI
KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ
KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR
RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA
MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP
LYLKDTESKRKRLYACIGFVIHRETQKKQIVHFDDDIDHHLHLKIAQGDLNPYDFHQPLA
NREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIHSLRQAEDK
LTMAIKRRKLSNANVVQETLKDTRSKFFNKPSMTVVENFKEKGDSIQDFKEDTNSQSLEE
PVSESQLSTQIPSSFITTNLEDDDNLSEEVSEVVSDIEEDRKNSEGKTIGNEIYNTDDDG
DGDTSEDYSETAESRVPTSSTTSFPGSSQRSISGCTKVLQKFRYSSSFSGVNANRQPLFP
RHVNQKSRGMVYVNQNRDDDCDDNDGKNQITQRPSLRKSLIGARSQRIVIDMKSVDERKS
FNSSPILHEESKKRDIETTKSSQARPAVRSISLLSQFVYKGK
Download sequence
Identical sequences P39875
NP_014676.1.97178 YOR033C YOR033C YOR033C 4932.YOR033C YOR033C YOR033C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]