SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR057W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR057W
Domain Number 1 Region: 185-283,320-375
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.15e-20
Family GS domain 0.007
Further Details:      
 
Domain Number 2 Region: 10-144
Classification Level Classification E-value
Superfamily TPR-like 0.0000486
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR057W   Protein: S000005583
Sequence length 395
Comment SGT1 SGDID:S000005583, Chr XV from 432188-433375, Verified ORF, "Probable cochaperone, regulates activity of Cyr1p (adenylyl cyclase); involved in assembly of the kinetochore complex, associates with the SCF (Skp1p/Cdc53p/F box protein) ubiquitin ligase complex"
Sequence
MPVEKDLKTAYKALYDEKEPLKALHLYDEILKGSPTNLTALIFKAACLEKLYFGFSDWHS
DATMENAKELLDKALMTAEGRGDRSKIGLVNFRYFVHFFNIKDYELAQSYFKKAKNLGYV
DDTLPLWEDRLETKLNKKNKKQKDSTNKHTIKPVESIENRGDNNSSHSPISPLKIETAPQ
ESPKFKIDWYQSSTSVTISLFTVNLPESKEQVNIYISPNDRRTLSISYQVPKSGSEFQYN
AKLSHEVDPKAVSLKIFPKKLEITLSKIDSTQWKKLEEDILTESSRLSDEGKNSDSATRL
LSAETASKERLSYPSSSKKKIDWSKLDIDEEADEEAGSADSFFQKLYAGADPDTKRAMMK
SFIESNGTALSTDWEDVSKGTVKTSPPEGMEPKHW
Download sequence
Identical sequences C7GSN0 N1NVR5 Q08446
4932.YOR057W YOR057W 355524 YOR057W YOR057W YOR057W YOR057W YOR057W YOR057W NP_014700.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]