SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR273C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR273C
Domain Number 1 Region: 165-293
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-18
Family UBX domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR273C   Protein: S000000477
Sequence length 436
Comment UBX7 SGDID:S000000477, Chr II from 749366-748056, reverse complement, Verified ORF, "UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p"
Sequence
MLEALFRDSVEEAINDSIKEGVVLAVYNTARDDQWLKSWFKGDDVSLDTLAEHSIWLRLV
KDTEQFQLFEQVFPNVVVPSIYLIRAGKIELIIQGEDDRHWEKLLACIGIKDKKAGESSS
RETNPGLAREEKSSRDVHRKNARERIAETTLEIQRREQLKQRKLAEEERERIIRLVRADR
AERKALDETHHRTLDDDKPLDVHDYIKDAQKLHSSKCVLQIRMTDGKTLKHEFNSSETLN
DVRKWVDVNRTDGDCPYSFHRGIPRVTFKDSDELKTLETLELTPRSALLLKPLETQNSGL
SVTGMEGPSLLGRLYKGFSTWWHNDKDPEVTSQREETSKPNRHEVRSSTPLSGAASSSCF
QYNNVREPVQSSAHASPMLTPSGTRYPSETNLTTSRSVSPNVFQFVNNDHQEDPEDPTTF
NGNNVHLEKKKDEDKK
Download sequence
Identical sequences N1P8M9 P38349
YBR273C YBR273C YBR273C YBR273C 4932.YBR273C NP_009832.1.97178 YBR273C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]