SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL091C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL091C
Domain Number 1 Region: 346-450
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000186
Family UBX domain 0.013
Further Details:      
 
Domain Number 2 Region: 141-264
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000165
Family UAS domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL091C   Protein: S000002249
Sequence length 455
Comment UBX3 SGDID:S000002249, Chr IV from 294759-293392, reverse complement, Verified ORF, "UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p, green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern"
Sequence
MDIFRHTFGNNDDSFIRIPGAFREEPPADLNGRTEDQNSNTNEPTQSRDGRLKSILHFLF
QAPLIVLYYLLNFIVRSSRLLKPLLRLHGFYQRKHNRLLDHSSQLHRLLENLENEAQAVT
CSEGNGNNDDGSNTDSTSNNESSGVQFSFGSLYNPENGTFSKSIMQNSYTELLDACSEQV
KFGVIYLHDPLLDNHMDYVNKILCSEAFVNMIRKYQVLLWYGDVTTSEGLQVSNALKIRQ
YPLLGIISLKAEKKIELIARVEGSISNYKAQDLEAIFSKNYSRLIQLRQQRQNIEMQRLI
RQQQDSRYQDSLRRDQQRESERLEQTQREQMEREHQRIENQWLLWRKSQLKPEPSSDKDA
SKVAIRLENGQRLVRKFDASLPTEEIYAFVELQLHDMLNSENDTLPVYQPANYQHQYSFK
LITPVPRRELDLSTKISDVSGIYPSGNIVMERLDE
Download sequence
Identical sequences A0A0L8VSH1 A6ZXN6 B5VFH6 C8Z6L2 E7KAH0 E7Q1V1 H0GDQ9 N1P5Y4 Q12229
YDL091C YDL091C YDL091C YDL091C YDL091C YDL091C YDL091C 4932.YDL091C YDL091C tr|A6ZXN6|A6ZXN6_YEAS7 NP_010192.1.97178 YDL091C YDL091C YDL091C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]