SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR518W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR518W
Domain Number 1 Region: 32-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.75e-26
Family PDI-like 0.0023
Further Details:      
 
Domain Number 2 Region: 333-484
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-23
Family PDI-like 0.0002
Further Details:      
 
Domain Number 3 Region: 239-362
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.46e-22
Family PDI-like 0.0000441
Further Details:      
 
Domain Number 4 Region: 145-238
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.81e-20
Family PDI-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR518W   Protein: S000002926
Sequence length 517
Comment EUG1 SGDID:S000002926, Chr IV from 1478601-1480154, Verified ORF, "Protein disulfide isomerase of the endoplasmic reticulum lumen, function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER"
Sequence
MQVTTRFISAIVSFCLFASFTLAENSARATPGSDLLVLTEKKFKSFIESHPLVLVEFFAP
WCLHSQILRPHLEEAASILKEHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNGRIFDG
QVYRGVKITDEITQYMIQLYEASVIYLNSEDEIQPYLENATLPVVINRGLTGLNETYQEV
ALDLAEDYVFLSLLDSEDKSLSIHLPNTTEPILFDGNVDSLVGNSVALTQWLKVVILPYF
TDIEPDLFPKYISSNLPLAYFFYTSEEELEDYTDLFTQLGKENRGQINFIALNSTMFPHH
VRFLNMREQFPLFAIHNMINNLKYGLPQLPEEEYAKLEKPQPLDRDMIVQLVKDYREGTA
KPIVKSEEIPKEQKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIAN
VLASDESVRDKILIAEVDSGANDILSFPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFE
FIKESGTHHIDGQAIYDKLHQAKDSEVSTEDTVHDEL
Download sequence
Identical sequences N1P931 P32474
NP_010806.1.97178 YDR518W YDR518W YDR518W YDR518W YDR518W YDR518W 4932.YDR518W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]