SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKL133C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YKL133C
Domain Number - Region: 98-162
Classification Level Classification E-value
Superfamily TPR-like 0.00158
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YKL133C   Protein: S000001616
Sequence length 463
Comment YKL133C SGDID:S000001616, Chr XI from 193069-191678, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MWKYLHRSVKNEGTVERLTNLNLFTNHRFKFYSTLKEQSFWRIPFKRRSKLQKWVLSTGI
VSFIAFNIWWVYWPHHTFPKPVAKILRKGLHSEIKKEGANYQKSLEYYLEALEECKAENV
DLLSDEYTGIEIKIGEMYEKLHMYNDATALYGDMLKKFYNELSKTTDKSTKRKFFLLKRD
LQILVRFNEINKDSETNATLLIMHLLLAQREFLENSPEFKNVLSKSELLNNQQLDWKNFK
GLPFIGKSKPDIQMHLNSKRKQELKIKEPESEQCVFMKELLTARDLYTRYCLNRSNLSGA
LNSKITTLEWMLLADSPLDDILLAQAELGSIFYLNSEKFEGSLYAIDNEPYKKSEPLELI
RSRLQENQNSCLQYSADCYKSIISFANENQYPKVAMESEMDQRILKALSLAHYGIGVINL
HKGRLRASKKELKKAIRISEMIRFNELIEEAQRELKKVDGTPI
Download sequence
Identical sequences YKL133C 4932.YKL133C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]