SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL229C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL229C
Domain Number 1 Region: 201-351
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.68e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0000000559
Further Details:      
 
Domain Number 2 Region: 103-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.33e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL229C   Protein: S000005173
Sequence length 354
Comment URE2 SGDID:S000005173, Chr XIV from 220202-219138, reverse complement, Verified ORF, "Nitrogen catabolite repression transcriptional regulator that acts by inhibition of GLN3 transcription in good nitrogen source; altered form of Ure2p creates [URE3] prion"
Sequence
MMNNNGNQVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQN
NNSGRNGSQNNDNENNIKNTLEQHRQQQQAFSDMSHVEYSRITKFFQEQPLEGYTLFSHR
SAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWE
SGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQK
IASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVW
LVGDKLTIADLAFVPWNNVVDRIGINIKIEFPEVYKWTKHMMRRPAVIKALRGE
Download sequence
Identical sequences A0A0L8VI99 A0A250WGF7 A6ZRL3 B3LP70 B5VQI2 C8ZG05 E7KHF2 E7QJN9 G2WLN6 N1NX06 P23202
NP_014170.1.97178 tr|A6ZRL3|A6ZRL3_YEAS7 YNL229C YNL229C YNL229C YNL229C YNL229C YNL229C YNL229C SCRT_03354 YNL229C YNL229C YNL229C YNL229C YNL229C YNL229C YNL229C YNL229C 4932.YNL229C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]