SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR166C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR166C
Domain Number 1 Region: 132-181,226-275
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000000000235
Family PIN domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR166C   Protein: S000005692
Sequence length 458
Comment SWT1 SGDID:S000005692, Chr XV from 648503-647127, reverse complement, Verified ORF, "Protein of unknown function; involved in transcription associated process; interacts genetically and physically with the TREX complex and RNA polymerase II; contains a PINc domain (PilT N terminus); localizes in the nucleus"
Sequence
MTDEKRAFPKGNNHIRSETFNGSVSHKISESIKDIASLRPHGKYTVQDIDNIIASTSSHE
NRGQSGDSNGCINHDEEGDIPMCDLNDESDVEMISEYLSSQREMEAQSVANYMPKINDDL
PLLNPPTLKTAFVVDTNFIISHLNTLEKLRSLSSTYHHLIIVPTTVIQELDGLKKSPDIA
RDNDDTTNQEHDRTIGTLARWGNDWIYKNLANLDSGLIGQKLKQSLNPGSLKDDSILDCC
LYFKEILNCFVILLSNDKNLCTKALTEDILTVSFRKNMDAKIIAMRAYEENQLRFANLRD
STVNNFDQNVTSYAHIPGIETPPLQFDKVSQNVFEQVKETIFFAIDHTLRKEYGEDIGFI
DYNPDKLTTIENASNYIYLFWVSVFSELFTCSKIKKNEWKSLPTVLKSKPTNLNDLRTFE
QFWETVLHFLFSKFTNEEKQSLEKQIHEWKTSINAIST
Download sequence
Identical sequences A0A0L8VH91 A6ZP11 B3LJJ9 C7GN58 C8ZGS7 E7KUG7 E7M0F9 E7QKT5 H0GNJ3 N1NWP8 Q12104
YOR166C SCRT_01559 4932.YOR166C YOR166C YOR166C YOR166C YOR166C YOR166C YOR166C YOR166C YOR166C YOR166C YOR166C YOR166C NP_014809.3.97178 YOR166C YOR166C tr|A6ZP11|A6ZP11_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]