SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000005977|e1vpkA1|227.1.1.1|A:13-132 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000005977|e1vpkA1|227.1.1.1|A:13-132
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily DNA clamp 2.39e-23
Family DNA polymerase III, beta subunit 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000005977|e1vpkA1|227.1.1.1|A:13-132
Sequence length 120
Sequence
mkvtvttlelkdkitiaskalakksvkpilagflfevkdgnfyicatdletgvkatvnaa
eisgearfvvpgdviqkmvkvlpdeitelslegdalvissgstvfrittmpadefpeitp
Download sequence
Identical sequences 000005977|e1vpkA1|227.1.1.1|A:13-132 d1vpka1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]