SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000011320|e1r5pA1|2485.1.1.27|A:7-96 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000011320|e1r5pA1|2485.1.1.27|A:7-96
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-28
Family KaiB-like 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000011320|e1r5pA1|2485.1.1.27|A:7-96
Sequence length 90
Sequence
tyvlklyvagntpnsvralktlknileqefqgiyalkvidvlknpqlaeedkilatptls
kilpppvrkiigdlsdrervligldllyee
Download sequence
Identical sequences 000011320|e1r5pA1|2485.1.1.27|A:7-96 000116786|e1r5pB1|2485.1.1.27|B:7-96 d1r5pa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]