SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000049417|e1djwB2|108.1.1.18|B:78-165 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000049417|e1djwB2|108.1.1.18|B:78-165
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily EF-hand 2.04e-21
Family EF-hand modules in multidomain proteins 0.00000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000049417|e1djwB2|108.1.1.18|B:78-165
Sequence length 88
Sequence
QRAEIDRAFEEAAGSAETLSVERLVTFLQHQQREEEAGPALALSLIERYEPSETAKAQRQ
MTKDGFLMYLLSADGNAFSLAHRRVYQD
Download sequence
Identical sequences 000049414|e1djgB2|108.1.1.18|B:78-165 000049415|e1djxB2|108.1.1.18|B:78-165 000049416|e1djyB2|108.1.1.18|B:78-165 000049417|e1djwB2|108.1.1.18|B:78-165 000049418|e1djzB2|108.1.1.18|B:78-165 000049419|e1djhB2|108.1.1.18|B:78-165 000049420|e2isdB2|108.1.1.18|B:78-165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]