SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000075270|e2ftkB1|225.1.1.10|B:13-191 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000075270|e2ftkB1|225.1.1.10|B:13-191
Domain Number 1 Region: 3-178
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 1.05e-67
Family Sporulation response regulatory protein Spo0B 0.00000000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000075270|e2ftkB1|225.1.1.10|B:13-191
Sequence length 179
Sequence
sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
ltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
Download sequence
Identical sequences 000075270|e2ftkB1|225.1.1.10|B:13-191 000075271|e1f51A1|225.1.1.10|A:3-181 000075272|e1ixmB1|225.1.1.10|B:13-191 000075273|e1f51D1|225.1.1.10|D:3-181 000075274|e2ftkA1|225.1.1.10|A:13-191 000075275|e1f51C1|225.1.1.10|C:3-181 000075276|e2ftkD1|225.1.1.10|D:13-191 000075277|e2ftkC1|225.1.1.10|C:13-191 000075278|e1f51B1|225.1.1.10|B:3-181 d1ixma_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]