SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000110079|e3cojE1|2111.68.1.6|E:26-132 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000110079|e3cojE1|2111.68.1.6|E:26-132
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily BRCT domain 1.13e-28
Family BRCT domain 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000110079|e3cojE1|2111.68.1.6|E:26-132
Sequence length 107
Sequence
msmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgiag
gkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresq
Download sequence
Identical sequences 000110068|e3cojA1|2111.68.1.6|A:26-132 000110070|e2ingX1|2111.68.1.6|X:4-110 000110071|e3cojF1|2111.68.1.6|F:26-132 000110072|e3cojG1|2111.68.1.6|G:26-132 000110073|e3cojB1|2111.68.1.6|B:26-132 000110075|e3cojX1|2111.68.1.6|X:26-132 000110077|e1y98A1|2111.68.1.6|A:5-111 000110078|e3cojD1|2111.68.1.6|D:26-132 000110079|e3cojE1|2111.68.1.6|E:26-132 000110084|e3cojC1|2111.68.1.6|C:26-132 d1y98a1 d2ingx1 d3coja1 d3cojb1 d3cojc1 d3cojd1 d3coje1 d3cojf1 d3cojg1 d3cojx1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]