SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000116218|e1tofA1|2485.1.1.40|A:1-112 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000116218|e1tofA1|2485.1.1.40|A:1-112
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.77e-31
Family Thioltransferase 0.0000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000116218|e1tofA1|2485.1.1.40|A:1-112
Sequence length 112
Sequence
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
Download sequence
Identical sequences 000116214|e1ep7A1|2485.1.1.40|A:1-112 000116216|e1ep7B1|2485.1.1.40|B:1-112 000116218|e1tofA1|2485.1.1.40|A:1-112 cath|current|1ep7A00/1-112 cath|current|1ep7B00/1-112 cath|current|1tofA00/1-112 d1ep7a_ d1ep7b_ d1tofa_ 1ep7A 1ep7_A 1ep7_B 1tof_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]