SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000116221|e1aazA1|2485.1.1.21|A:1-87 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000116221|e1aazA1|2485.1.1.21|A:1-87
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-17
Family Thioltransferase 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000116221|e1aazA1|2485.1.1.21|A:1-87
Sequence length 87
Sequence
MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQ
IGLTMPQVFAPDGSHIGGFDQLREYFK
Download sequence
Identical sequences A0A023ZVL9 A0A097BWS7 A0A097J0X2 A0A097J1Q3 A0A097J2G0 A0A097J3B0 A0A097J405 A0A097J4W6 A0A097J5K7 A0A097J780 A0A097J7U6 A0A097J8Q2 A0A0A0PU06 A0A0F6TII7 A0A0M7Q9N6 A0A0M7QB84 A0A0M7QBS8 A0A0M7QC88 A0A0M7QE68 A0A159B735 A0A161H7L4 A0A162EBY7 A0A173GAF2 A0A193H147 A0A193H1M9 A0A1J0GTF6 A0A1L7DR19 A0A1W5LJE9 A0A249XXQ5 A0A249XY65 A0A249XZ07 A0A291B026 A0A291LCT4 C3V1E6 C3V274 F2VXA6 G0X5K8 I6ZY60 I7LHH0 P00276 S5MKV9
1aazA C3V1E6_9CAUD C3V274_BPR51 D9IEB8_BPT4 GLRX_BPT4 NP_049698.1.34590 WP_015969245.1.100868 WP_015969245.1.45544 WP_015969245.1.81320 YP_002854043.1.35387 YP_002854420.1.52523 YP_004414983.1.39753 YP_007004827.1.71933 YP_009102557.1.19893 YP_009110904.1.41069 YP_009148529.1.10008 YP_009149327.1.33003 YP_009153686.1.25605 YP_009197370.1.55766 YP_009210273.1.84547 YP_009279080.1.5225 YP_009281422.1.77108 YP_009284105.1.77798 YP_009288453.1.44423 YP_009290352.1.45152 gi|228861020|ref|YP_002854043.1| gi|228861399|ref|YP_002854420.1| gi|330858608|ref|YP_004414983.1| gi|422934867|ref|YP_007004827.1| gi|9632795|ref|NP_049698.1| 1aaz_A 1aaz_B 1de1_A 1de2_A 000116219|e1de1A1|2485.1.1.21|A:1-87 000116220|e1de2A1|2485.1.1.21|A:1-87 000116221|e1aazA1|2485.1.1.21|A:1-87 000116222|e1aazB1|2485.1.1.21|B:1-87 cath|current|1aazA00/1-87 cath|current|1aazB00/1-87 cath|current|1de1A00/1-87 cath|current|1de2A00/1-87 d1aaza_ d1aazb_ d1de1a_ d1de2a_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]