SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000116659|e1byeB2|2485.1.1.76|B:2-80 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000116659|e1byeB2|2485.1.1.76|B:2-80
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.92e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000116659|e1byeB2|2485.1.1.76|B:2-80
Sequence length 79
Sequence
PMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQDGD
LYLFESRAICKYAARKNKP
Download sequence
Identical sequences 000116657|e1byeA2|2485.1.1.76|A:2-80 000116659|e1byeB2|2485.1.1.76|B:2-80 000116661|e1byeD2|2485.1.1.76|D:2-80 000116662|e1axdB2|2485.1.1.76|B:2-80 000116663|e1axdA2|2485.1.1.76|A:2-80 000116664|e1byeC2|2485.1.1.76|C:2-80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]