SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000116914|e1yexE1|2485.1.1.4|E:1-165 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000116914|e1yexE1|2485.1.1.4|E:1-165
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.34e-46
Family Glutathione peroxidase-like 0.0000000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000116914|e1yexE1|2485.1.1.4|E:1-165
Sequence length 165
Sequence
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfdhkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc
Download sequence
Identical sequences 000116912|e1yexB1|2485.1.1.4|B:1-165 000116914|e1yexE1|2485.1.1.4|E:1-165 cath|current|1yexB00/1-165 cath|current|1yexE00/1-165 d1yexb_ d1yexe_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]