SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000116995|e2b7kB1|2485.1.1.35|B:18-181 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000116995|e2b7kB1|2485.1.1.35|B:18-181
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.44e-51
Family Glutathione peroxidase-like 0.0000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000116995|e2b7kB1|2485.1.1.35|B:18-181
Sequence length 164
Sequence
pslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlsskygi
tlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyfstppnvkpg
qdylvdhsiffylmdpegqfvdalgrnydektgvdkivehvksy
Download sequence
Identical sequences 000116990|e2b7kD1|2485.1.1.35|D:18-181 000116995|e2b7kB1|2485.1.1.35|B:18-181 cath|current|2b7kB00/113-276 cath|current|2b7kD00/113-276 d2b7kb_ d2b7kd_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]