SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000116997|e1pn0C3|2485.1.1.31|C:463-663 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000116997|e1pn0C3|2485.1.1.31|C:463-663
Domain Number 1 Region: 5-200
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.81e-65
Family Glutathione peroxidase-like 0.00000000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000116997|e1pn0C3|2485.1.1.31|C:463-663
Sequence length 201
Sequence
nlvtdkksskqelakncvvgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatd
atqmsrikkfaayldsensvisrytpkgadrnsridvitihschrddiemhdfpapalhp
kwqydfiyadcdswhhphpksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfs
gilvepkeksgaqteadwtks
Download sequence
Identical sequences 000011342|e1pn0A3|2485.1.1.31|A:463-663 000116997|e1pn0C3|2485.1.1.31|C:463-663 000116999|e1pn0B3|2485.1.1.31|B:463-663 000117000|e1pn0D3|2485.1.1.31|D:463-663 d1pn0a2 d1pn0b2 d1pn0c2 d1pn0d2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]