SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000133701|e1kwoB2|108.1.1.41|B:84-153 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000133701|e1kwoB2|108.1.1.41|B:84-153
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000117
Family Calmodulin-like 0.0000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000133701|e1kwoB2|108.1.1.41|B:84-153
Sequence length 70
Sequence
DSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVK
FTAMIKGSGE
Download sequence
Identical sequences 000119094|e1wdcB2|108.1.1.41|B:84-153 000133689|e1s5gY2|108.1.1.41|Y:84-153 000133690|e1l2oB2|108.1.1.41|B:84-153 000133692|e1sr6B2|108.1.1.41|B:84-153 000133694|e1kqmB2|108.1.1.41|B:84-153 000133697|e1kk7Y2|108.1.1.41|Y:84-153 000133701|e1kwoB2|108.1.1.41|B:84-153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]