SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000133704|e1dguA1|108.1.1.35|A:95-183 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000133704|e1dguA1|108.1.1.35|A:95-183
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily EF-hand 8.64e-20
Family Calmodulin-like 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000133704|e1dguA1|108.1.1.35|A:95-183
Sequence length 89
Sequence
TPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDI
DRDGTINLSEFQHVISRSPDFASSFKIVL
Download sequence
Identical sequences 000119099|e1xo5A1|108.1.1.35|A:95-183 000133703|e1dgvA1|108.1.1.35|A:95-183 000133704|e1dguA1|108.1.1.35|A:95-183 000147992|e2lm5A2|108.1.1.35|A:126-214 000180170|e2l4hA1|108.1.1.35|A:126-214 001388264|e1y1aA2|108.1.1.35|A:95-183 001388266|e1y1aB2|108.1.1.35|B:95-183 001759304|e1xo5B1|108.1.1.35|B:95-183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]