SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000148360|e3unfH1|210.1.1.4|H:1-220 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000148360|e3unfH1|210.1.1.4|H:1-220
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.47e-57
Family Proteasome subunits 0.000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000148360|e3unfH1|210.1.1.4|H:1-220
Sequence length 220
Sequence
TTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAA
SKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLVVGGVDLNGPQLYEVHPHGSYS
RLPFTALGSGQGAAVALLEDRFQPNMTLEAAQELLVEAITAGILSDLGSGGNVDACVITA
GGAKLQRALSTPTEPVQRAGRYRFAPGTTPVLTREVRPLT
Download sequence
Identical sequences 000148360|e3unfH1|210.1.1.4|H:1-220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]