SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000148542|e4ds7A2|108.1.1.41|A:81-147 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000148542|e4ds7A2|108.1.1.41|A:81-147
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily EF-hand 3.87e-21
Family Calmodulin-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000148542|e4ds7A2|108.1.1.41|A:81-147
Sequence length 67
Sequence
DSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIKQ
FAALLSK
Download sequence
Identical sequences 000148542|e4ds7A2|108.1.1.41|A:81-147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]