SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000224117|e1eg5A1|3016.1.1.93|A:259-376 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000224117|e1eg5A1|3016.1.1.93|A:259-376
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.42e-24
Family Cystathionine synthase-like 0.00000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000224117|e1eg5A1|3016.1.1.93|A:259-376
Sequence length 118
Sequence
SEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFPNIRGSTLQNLLSGYGIYV
STSSACTSKDERLRHVLDAMGVDRRIAQGAIRISLCKYNTEEEVDYFLKKIEEILSFL
Download sequence
Identical sequences 000224117|e1eg5A1|3016.1.1.93|A:259-376 001152522|e1ecxA2|3016.1.1.93|A:259-376 001152524|e1ecxB2|3016.1.1.93|B:259-376 001194030|e1eg5B2|3016.1.1.93|B:259-376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]