SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000336448|e2jptB1|108.1.1.8|B:1-93 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000336448|e2jptB1|108.1.1.8|B:1-93
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily EF-hand 2.66e-25
Family S100 proteins 0.00009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000336448|e2jptB1|108.1.1.8|B:1-93
Sequence length 93
Sequence
gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdadavdkvmke
ldedgdgevdfqeyvvlvaaltvacnnffwens
Download sequence
Identical sequences 000167070|e2jptA1|108.1.1.8|A:1-93 000336448|e2jptB1|108.1.1.8|B:1-93 cath|current|2jptA00/1-93 cath|current|2jptB00/1-93 d2jpta_ d2jptb_ 2jpt_A 2jpt_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]